PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G142925.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family FAR1
Protein Properties Length: 149aa    MW: 17434.1 Da    PI: 10.3786
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G142925.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR132.82.3e-105455091
                  FAR1 50 kerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                           +r+t+ + + +C   ++vk+e +gkw+v +l+l+HnHel+p
  Sobic.006G142925.1.p  5 PKRKTNIQVKSNCLVLMEVKEE-NGKWKVVRLDLDHNHELSP 45
                          6899*****************9.*****************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-7645IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
KGKGPKRKTN IQVKSNCLVL MEVKEENGKW KVVRLDLDHN HELSPDNRNQ LFSGRKYMTD  60
MEKAMIRTLN GNNIPTRNMI AILSYLRGNV TALPYKTKHV QNERTKINRE IKGNDMNTVM  120
QYFLKRAAED QTFFYKFLVD EENKVERI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457812.16e-82hypothetical protein SORBIDRAFT_03g013920
TrEMBLC5XJX77e-82C5XJX7_SORBI; Putative uncharacterized protein Sb03g013920
STRINGSb03g013920.12e-81(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.16e-09FAR1-related sequence 5